PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00166.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 263aa    MW: 29645 Da    PI: 4.5408
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00166.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.53e-181461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEde+l+ +v+++G   W+t +++ g++R++k+c++rw +yl
  Rsa1.0_00166.1_g00001.1 14 KGAWTPEEDERLIAYVQLHGESGWRTLPEKAGLKRCGKSCRLRWANYL 61
                             79********************************************97 PP

2Myb_DNA-binding52.11.5e-1667111147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg +T+eEd+ ++++++++G++ W+ Ia  ++ gRt++++k++w++ 
  Rsa1.0_00166.1_g00001.1  67 RGEFTPEEDDTIIKLHALMGNK-WAGIATSLP-GRTDNEIKNYWNTN 111
                              899*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.083961IPR017930Myb domain
SuperFamilySSF466897.34E-3011108IPR009057Homeodomain-like
SMARTSM007179.4E-131363IPR001005SANT/Myb domain
PfamPF002496.0E-161461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-241568IPR009057Homeodomain-like
CDDcd001672.72E-91661No hitNo description
PROSITE profilePS5129426.01562116IPR017930Myb domain
SMARTSM007171.7E-1666114IPR001005SANT/Myb domain
PfamPF002491.2E-1567112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-2669116IPR009057Homeodomain-like
CDDcd001672.26E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MVRTPCCKEE GIRKGAWTPE EDERLIAYVQ LHGESGWRTL PEKAGLKRCG KSCRLRWANY  60
LKPDIKRGEF TPEEDDTIIK LHALMGNKWA GIATSLPGRT DNEIKNYWNT NLKKRLTQKA  120
RKYAGASNRD LLTGIIIRNS SNIAEGSLNS VEVDSPTENS TFTLLNKEAA RSSALTSFLT  180
NNMSSSSGLS DNCSFADNLD LFFSNEEISD MYMNVDNVGI MEELKDILNY GGADAGDVEN  240
SPEFLDSWNE EDDLDLENYY WVR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ6156041e-137HQ615604.1 Brassica rapa subsp. pekinensis cultivar A5-2-1 MYB34-3 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013616108.11e-166PREDICTED: transcription factor MYB34-like
RefseqXP_013616107.11e-166PREDICTED: transcription factor MYB34-like
RefseqXP_013616105.11e-166PREDICTED: transcription factor MYB34-like
RefseqXP_013616104.11e-166PREDICTED: transcription factor MYB34-like
RefseqXP_013616103.11e-166PREDICTED: transcription factor MYB34-like
RefseqXP_013616102.11e-166PREDICTED: transcription factor MYB34-like
SwissprotO643991e-118MYB34_ARATH; Transcription factor MYB34
TrEMBLA0A0D3AY341e-166A0A0D3AY34_BRAOL; Uncharacterized protein
STRINGBra029350.1-P1e-159(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM93311637
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60890.11e-120myb domain protein 34